Lineage for d2qapc_ (2qap C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836735Species Trypanosome (Leishmania mexicana) [TaxId:5665] [255557] (3 PDB entries)
  8. 2836738Domain d2qapc_: 2qap C: [150322]
    automated match to d2alda_
    complexed with po4

Details for d2qapc_

PDB Entry: 2qap (more details), 1.59 Å

PDB Description: fructose-1,6-bisphosphate aldolase from leishmania mexicana
PDB Compounds: (C:) fructose-1,6-bisphosphate aldolase

SCOPe Domain Sequences for d2qapc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qapc_ c.1.10.0 (C:) automated matches {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
msrvtvlqsqlpaynrlktpyeseliatvkklttpgkgllaadesigsctkrfqpiglsn
teehrrqyralmleaegfeqyisgvilhdetvgqkasngqtfpeyltargvvpgiktdmg
lcpllegaegeqmtegldgyvkrasayykkgcrfckwrnvykiqngtvsesavrfnaetl
aryailsqmsglvpivepevmidgkhdidtcqrvsehvwrevvaalqrhgviwegcllkp
nmvvpgaesgktaapeqvahytvmtlartmpamlpgvmflsgglsevqaseylnainnsp
lprpyflsfsyaralqssalkawggkesglaagrraflhrarmnsmaqlgkykrsddd

SCOPe Domain Coordinates for d2qapc_:

Click to download the PDB-style file with coordinates for d2qapc_.
(The format of our PDB-style files is described here.)

Timeline for d2qapc_: