SCOPe 2.04: Domain d2qaoi2: 2qao I:1-72

Lineage for d2qaoi2 (2qao I:1-72)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
   beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123

4. Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family)

5. Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
   Pfam PF03946

6. Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)

7. Species Escherichia coli [TaxId:562] [160201] (29 PDB entries)
   Uniprot P0A7J7 1-72

8. Domain d2qaoi2: 2qao I:1-72 [150302]
   Other proteins in same PDB: d2qao01, d2qao11, d2qao31, d2qao41, d2qaoc1, d2qaoc2, d2qaod1, d2qaoe1, d2qaof1, d2qaog1, d2qaog2, d2qaoh1, d2qaoh2, d2qaoi1, d2qaoj1, d2qaok1, d2qaol1, d2qaom1, d2qaon1, d2qaoo1, d2qaop1, d2qaoq1, d2qaor1, d2qaos1, d2qaot1, d2qaou1, d2qaov1, d2qaow1, d2qaox1, d2qaoy1, d2qaoz1
   automatically matched to 2AW4 I:1-72
   protein/RNA complex; complexed with mg, nmy, zn

Details for d2qaoi2

PDB Entry: 2qao, 3.21 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with neomycin. This file contains the 50S subunit of the second 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2qaoi2:

Sequence; same for both SEQRES and ATOM records:

>d2qaoi2 d.47.1.1 (I:1-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]}
akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv
yadrsftfvtkt

Timeline for d2qaoi2:

• d2qaoi2 first appeared in SCOP 1.75
  
• d2qaoi2 appears in SCOPe 2.03
  
• d2qaoi2 appears in SCOPe 2.05
  
• d2qaoi2 appears in the current release, SCOPe 2.08