Lineage for d2mbw__ (2mbw -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) Protein Myoglobin [46469] (9 species) Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (131 PDB entries) 
Domain d2mbw__: 2mbw - [15030]
Details for d2mbw__
PDB Entry: 2mbw (more details), 1.5 Å
PDB Description: recombinant sperm whale myoglobin (met)
SCOP Domain Sequences for d2mbw__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mbw__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg
SCOP Domain Coordinates for d2mbw__:
Click to download the PDB-style file with coordinates for d2mbw__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2mbw__:
- d2mbw__ appears in SCOP 1.57
- d2mbw__ appears in the current release, SCOPe 2.08, called d2mbwa_
View in 3D