Lineage for d2qaog1 (2qao G:1-81)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1219397Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 1219398Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 1219399Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 1219400Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 1219417Species Escherichia coli [TaxId:562] [160796] (27 PDB entries)
    Uniprot P02390 1-81! Uniprot P02390 82-176
  8. 1219420Domain d2qaog1: 2qao G:1-81 [150297]
    Other proteins in same PDB: d2qao01, d2qao11, d2qao31, d2qao41, d2qaoc1, d2qaoc2, d2qaod1, d2qaoe1, d2qaof1, d2qaoh1, d2qaoh2, d2qaoi1, d2qaoi2, d2qaoj1, d2qaok1, d2qaol1, d2qaom1, d2qaon1, d2qaoo1, d2qaop1, d2qaoq1, d2qaor1, d2qaos1, d2qaot1, d2qaou1, d2qaov1, d2qaow1, d2qaox1, d2qaoy1, d2qaoz1
    automatically matched to 2AW4 G:1-81
    protein/RNA complex; complexed with mg, nmy, zn

Details for d2qaog1

PDB Entry: 2qao (more details), 3.21 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with neomycin. This file contains the 50S subunit of the second 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (G:) 50S ribosomal protein L6

SCOPe Domain Sequences for d2qaog1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qaog1 d.141.1.1 (G:1-81) Ribosomal protein L6 {Escherichia coli [TaxId: 562]}
srvakapvvvpagvdvkingqvitikgkngeltrtlndavevkhadntltfgprdgyadg
waqagtarallnsmvigvteg

SCOPe Domain Coordinates for d2qaog1:

Click to download the PDB-style file with coordinates for d2qaog1.
(The format of our PDB-style files is described here.)

Timeline for d2qaog1: