Class a: All alpha proteins [46456] (284 folds) |
Fold a.75: Ribosomal protein S7 [47972] (1 superfamily) core: 5 helices; contains one more helix and a beta-hairpin outside the core |
Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) |
Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein) |
Protein Ribosomal protein S7 [47975] (4 species) |
Species Escherichia coli [TaxId:562] [158599] (24 PDB entries) Uniprot P02359 2-151 |
Domain d2qang1: 2qan G:2-151 [150274] Other proteins in same PDB: d2qanb1, d2qanc1, d2qanc2, d2qand1, d2qane1, d2qane2, d2qanf1, d2qanh1, d2qani1, d2qanj1, d2qank1, d2qanl1, d2qanm1, d2qann1, d2qanp1, d2qanq1, d2qanr1, d2qans1, d2qant1, d2qanu1 automatically matched to 2AVY G:2-151 complexed with mg, nmy |
PDB Entry: 2qan (more details), 3.21 Å
SCOP Domain Sequences for d2qang1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qang1 a.75.1.1 (G:2-151) Ribosomal protein S7 {Escherichia coli [TaxId: 562]} rrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkseleaf evalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrlan elsdaaenkgtavkkredvhrmaeankafa
Timeline for d2qang1: