Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
Protein Ribosomal protein S3 N-terminal domain [54816] (4 species) |
Species Escherichia coli [TaxId:562] [160236] (24 PDB entries) Uniprot P0A7V3 1-105 |
Domain d2qanc1: 2qan C:1-105 [150268] Other proteins in same PDB: d2qanb1, d2qanc2, d2qand1, d2qane1, d2qane2, d2qanf1, d2qang1, d2qanh1, d2qani1, d2qanj1, d2qank1, d2qanl1, d2qanm1, d2qann1, d2qanp1, d2qanq1, d2qanr1, d2qans1, d2qant1, d2qanu1 automatically matched to 2AVY C:1-105 protein/RNA complex; complexed with mg, nmy |
PDB Entry: 2qan (more details), 3.21 Å
SCOPe Domain Sequences for d2qanc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qanc1 d.52.3.1 (C:1-105) Ribosomal protein S3 N-terminal domain {Escherichia coli [TaxId: 562]} gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaev
Timeline for d2qanc1: