SCOPe 2.04: Domain d2qamh2: 2qam H:1-58

Lineage for d2qamh2 (2qam H:1-58)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.1: L9 N-domain-like [55658] (3 families)

5. Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
   automatically mapped to Pfam PF01281

6. Protein Ribosomal protein L9 N-domain [55660] (3 species)

7. Species Escherichia coli [TaxId:562] [160581] (29 PDB entries)
   Uniprot P0A7R1 1-58

8. Domain d2qamh2: 2qam H:1-58 [150247]
   Other proteins in same PDB: d2qam01, d2qam11, d2qam21, d2qam31, d2qam41, d2qamc1, d2qamc2, d2qamd1, d2qame1, d2qamf1, d2qamg1, d2qamg2, d2qamh1, d2qami1, d2qami2, d2qamj1, d2qamk1, d2qaml1, d2qamm1, d2qamn1, d2qamo1, d2qamp1, d2qamq1, d2qamr1, d2qams1, d2qamt1, d2qamu1, d2qamv1, d2qamw1, d2qamx1, d2qamy1, d2qamz1
   automatically matched to 2AW4 H:1-58
   protein/RNA complex; complexed with mg, nmy, zn

Details for d2qamh2

PDB Entry: 2qam, 3.21 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with neomycin. This file contains the 50S subunit of the first 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (H:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2qamh2:

Sequence; same for both SEQRES and ATOM records:

>d2qamh2 d.100.1.1 (H:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]}
mqvilldkvanlgslgdqvnvkagyarnflvpqgkavpatkknieffearraeleakl

Timeline for d2qamh2:

• d2qamh2 first appeared in SCOP 1.75
  
• d2qamh2 appears in SCOPe 2.03
  
• d2qamh2 appears in SCOPe 2.05
  
• d2qamh2 appears in the current release, SCOPe 2.08