SCOPe 2.07: Domain d2qamg2: 2qam G:82-176

Lineage for d2qamg2 (2qam G:82-176)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)
   automatically mapped to Pfam PF00347

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Escherichia coli [TaxId:562] [160796] (27 PDB entries)
   Uniprot P02390 1-81! Uniprot P02390 82-176

8. Domain d2qamg2: 2qam G:82-176 [150245]
   Other proteins in same PDB: d2qam01, d2qam11, d2qam21, d2qam31, d2qam41, d2qamc1, d2qamc2, d2qamd1, d2qame1, d2qamf1, d2qamh1, d2qamh2, d2qami1, d2qami2, d2qamj1, d2qamk1, d2qaml1, d2qamm1, d2qamn1, d2qamo1, d2qamp1, d2qamq1, d2qamr1, d2qams1, d2qamt1, d2qamu1, d2qamv1, d2qamw1, d2qamx1, d2qamy1, d2qamz1
   protein/RNA complex; complexed with mg, nmy, zn
   protein/RNA complex; complexed with mg, nmy, zn

Details for d2qamg2

PDB Entry: 2qam, 3.21 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with neomycin. This file contains the 50S subunit of the first 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (G:) 50S ribosomal protein L6

SCOPe Domain Sequences for d2qamg2:

Sequence; same for both SEQRES and ATOM records:

>d2qamg2 d.141.1.1 (G:82-176) Ribosomal protein L6 {Escherichia coli [TaxId: 562]}
ftkklqlvgvgyraavkgnvinlslgfshpvdhqlpagitaecptqteivlkgadkqvig
qvaadlrayrrpepykgkgvryadevvrtkeakkk

Timeline for d2qamg2:

• d2qamg2 first appeared in SCOP 1.75
  
• d2qamg2 appears in SCOPe 2.06
  
• d2qamg2 appears in the current release, SCOPe 2.08