Lineage for d2qamc1 (2qam C:125-269)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783937Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2784107Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 2784108Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)
  7. 2784118Species Escherichia coli [TaxId:562] [159027] (27 PDB entries)
    Uniprot P60422 125-269
  8. 2784120Domain d2qamc1: 2qam C:125-269 [150239]
    Other proteins in same PDB: d2qam01, d2qam11, d2qam21, d2qam31, d2qam41, d2qamc2, d2qamd1, d2qame1, d2qamf1, d2qamg1, d2qamg2, d2qamh1, d2qamh2, d2qami1, d2qami2, d2qamj1, d2qamk1, d2qaml1, d2qamm1, d2qamn1, d2qamo1, d2qamp1, d2qamq1, d2qamr1, d2qams1, d2qamt1, d2qamu1, d2qamv1, d2qamw1, d2qamx1, d2qamy1, d2qamz1
    protein/RNA complex; complexed with mg, nmy, zn
    protein/RNA complex; complexed with mg, nmy, zn

Details for d2qamc1

PDB Entry: 2qam (more details), 3.21 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with neomycin. This file contains the 50S subunit of the first 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2qamc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qamc1 b.34.5.3 (C:125-269) C-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
pgntlpmrnipvgstvhnvemkpgkggqlarsagtyvqivardgayvtlrlrsgemrkve
adcratlgevgnaehmlrvlgkagaarwrgvrptvrgtamnpvdhphgggegrnfgkhpv
tpwgvqtkgkktrsnkrtdkfivrr

SCOPe Domain Coordinates for d2qamc1:

Click to download the PDB-style file with coordinates for d2qamc1.
(The format of our PDB-style files is described here.)

Timeline for d2qamc1: