Lineage for d1bzra_ (1bzr A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. Protein Myoglobin [46469] (10 species)
  7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (316 PDB entries)
    Uniprot P02185
  8. Domain d1bzra_: 1bzr A: [15023]
    complexed with cmo, hem, so4

Details for d1bzra_

PDB Entry: 1bzr (more details), 1.1500000000000001 Å

PDB Description: atomic resolution crystal structure analysis of native deoxy and co myoglobin from sperm whale at room temperature
PDB Compounds: (A:) protein (myoglobin)

SCOPe Domain Sequences for d1bzra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzra_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d1bzra_ are not available.

Timeline for d1bzra_: