Class a: All alpha proteins [46456] (284 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension |
Protein Ribosomal protein S13 [46948] (2 species) |
Species Escherichia coli [TaxId:562] [158360] (26 PDB entries) Uniprot P0A7S9 1-114 |
Domain d2qalm1: 2qal M:1-114 [150226] Other proteins in same PDB: d2qalb1, d2qalc1, d2qalc2, d2qald1, d2qale1, d2qale2, d2qalf1, d2qalg1, d2qalh1, d2qali1, d2qalj1, d2qalk1, d2qall1, d2qaln1, d2qalp1, d2qalq1, d2qalr1, d2qals1, d2qalt1, d2qalu1 automatically matched to 2AVY M:1-114 protein/RNA complex; complexed with mg, nmy |
PDB Entry: 2qal (more details), 3.21 Å
SCOPe Domain Sequences for d2qalm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qalm1 a.156.1.1 (M:1-114) Ribosomal protein S13 {Escherichia coli [TaxId: 562]} ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkp
Timeline for d2qalm1: