Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) |
Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) |
Protein Ribosomal protein S6 [54997] (4 species) |
Species Escherichia coli [TaxId:562] [160317] (24 PDB entries) Uniprot P02358 1-100 |
Domain d2qalf1: 2qal F:1-100 [150219] Other proteins in same PDB: d2qalb1, d2qalc1, d2qalc2, d2qald1, d2qale1, d2qale2, d2qalg1, d2qalh1, d2qali1, d2qalj1, d2qalk1, d2qall1, d2qalm1, d2qaln1, d2qalp1, d2qalq1, d2qalr1, d2qals1, d2qalt1, d2qalu1 protein/RNA complex; complexed with mg, nmy protein/RNA complex; complexed with mg, nmy |
PDB Entry: 2qal (more details), 3.21 Å
SCOPe Domain Sequences for d2qalf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qalf1 d.58.14.1 (F:1-100) Ribosomal protein S6 {Escherichia coli [TaxId: 562]} mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv lmnveapqevidelettfrfndavirsmvmrtkhavteas
Timeline for d2qalf1: