Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.1: Translational machinery components [54212] (4 proteins) |
Protein Ribosomal protein S5, C-terminal domain [54215] (3 species) |
Species Escherichia coli [TaxId:562] [159906] (24 PDB entries) Uniprot P0A7W1 78-158 |
Domain d2qale1: 2qal E:78-158 [150217] Other proteins in same PDB: d2qalb1, d2qalc1, d2qalc2, d2qald1, d2qale2, d2qalf1, d2qalg1, d2qalh1, d2qali1, d2qalj1, d2qalk1, d2qall1, d2qalm1, d2qaln1, d2qalp1, d2qalq1, d2qalr1, d2qals1, d2qalt1, d2qalu1 protein/RNA complex; complexed with mg, nmy protein/RNA complex; complexed with mg, nmy |
PDB Entry: 2qal (more details), 3.21 Å
SCOPe Domain Sequences for d2qale1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qale1 d.14.1.1 (E:78-158) Ribosomal protein S5, C-terminal domain {Escherichia coli [TaxId: 562]} gtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvhnvlakaygstnpinvvr atidglenmnspemvaakrgk
Timeline for d2qale1: