SCOPe 2.01: Domain d2qadh1: 2qad H:1-113

Lineage for d2qadh1 (2qad H:1-113)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (36 PDB entries)

8. Domain d2qadh1: 2qad H:1-113 [150209]
   Other proteins in same PDB: d2qadb1, d2qadb2, d2qadd2, d2qadf1, d2qadf2, d2qadh2
   automatically matched to d1rzga1
   complexed with edo, mla, nag

Details for d2qadh1

PDB Entry: 2qad, 3.3 Å

PDB Description: structure of tyrosine-sulfated 412d antibody complexed with hiv-1 yu2 gp120 and cd4

PDB Compounds: (H:) anti-HIV-1 antibody 412d heavy chain

SCOPe Domain Sequences for d2qadh1:

Sequence; same for both SEQRES and ATOM records:

>d2qadh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
evqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmggiipifniahy
aqrfqgrvsitadeststaymelsslrsedtavfycaspypndyndyapeegmswyfdlw
grgtlvtvsp

Timeline for d2qadh1:

• d2qadh1 first appeared in SCOP 1.75
  
• d2qadh1 appears in SCOPe 2.02
  
• d2qadh1 appears in the current release, SCOPe 2.08