![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (8 proteins) |
![]() | Protein CD4 C2-set domains [49149] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries) |
![]() | Domain d2qadf2: 2qad F:98-178 [150208] Other proteins in same PDB: d2qadb1, d2qadd1, d2qadd2, d2qadf1, d2qadh1, d2qadh2 automatically matched to d1g9mc2 complexed with edo, mla, nag |
PDB Entry: 2qad (more details), 3.3 Å
SCOPe Domain Sequences for d2qadf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qadf2 b.1.1.3 (F:98-178) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw tctvlqnqkkvefkidivvla
Timeline for d2qadf2: