SCOPe 2.08: Domain d2qadf2: 2qad F:98-178

Lineage for d2qadf2 (2qad F:98-178)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.3: C2 set domains [49142] (8 proteins)
Protein CD4 C2-set domains [49149] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries)
Domain d2qadf2: 2qad F:98-178 [150208]
Other proteins in same PDB: d2qadb1, d2qadd1, d2qadd2, d2qadf1, d2qadh1, d2qadh2
automatically matched to d1g9mc2
complexed with edo, mla, nag

Details for d2qadf2

PDB Entry: 2qad (more details), 3.3 Å

PDB Description: structure of tyrosine-sulfated 412d antibody complexed with hiv-1 yu2 gp120 and cd4

PDB Compounds: (F:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d2qadf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qadf2 b.1.1.3 (F:98-178) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

SCOPe Domain Coordinates for d2qadf2:

Click to download the PDB-style file with coordinates for d2qadf2.
(The format of our PDB-style files is described here.)

Timeline for d2qadf2: