Lineage for d2qadd1 (2qad D:1-113)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287638Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1287745Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries)
  8. 1287796Domain d2qadd1: 2qad D:1-113 [150205]
    Other proteins in same PDB: d2qadb1, d2qadb2, d2qadd2, d2qadf1, d2qadf2, d2qadh2
    automatically matched to d1rzga1
    complexed with edo, mla, nag

Details for d2qadd1

PDB Entry: 2qad (more details), 3.3 Å

PDB Description: structure of tyrosine-sulfated 412d antibody complexed with hiv-1 yu2 gp120 and cd4
PDB Compounds: (D:) anti-HIV-1 antibody 412d heavy chain

SCOPe Domain Sequences for d2qadd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qadd1 b.1.1.1 (D:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
evqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmggiipifniahy
aqrfqgrvsitadeststaymelsslrsedtavfycaspypndyndyapeegmswyfdlw
grgtlvtvsp

SCOPe Domain Coordinates for d2qadd1:

Click to download the PDB-style file with coordinates for d2qadd1.
(The format of our PDB-style files is described here.)

Timeline for d2qadd1: