![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
![]() | Protein automated matches [190306] (9 species) not a true protein |
![]() | Species Streptomyces griseus [TaxId:1911] [187119] (8 PDB entries) |
![]() | Domain d2qaaa_: 2qaa A: [150201] automated match to d1sgde_ complexed with acy, cl, edo, epe, gol, so4, tyr |
PDB Entry: 2qaa (more details), 1.23 Å
SCOPe Domain Sequences for d2qaaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qaaa_ b.47.1.1 (A:) automated matches {Streptomyces griseus [TaxId: 1911]} isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay gvsvy
Timeline for d2qaaa_: