Lineage for d2qaaa_ (2qaa A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 952976Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 953163Protein automated matches [190306] (2 species)
    not a true protein
  7. 953167Species Streptomyces griseus [TaxId:1911] [187119] (8 PDB entries)
  8. 953168Domain d2qaaa_: 2qaa A: [150201]
    automated match to d1sgde_
    complexed with acy, cl, edo, epe, gol, so4, tyr

Details for d2qaaa_

PDB Entry: 2qaa (more details), 1.23 Å

PDB Description: Crystal structure of the second tetrahedral intermediates of SGPB at pH 7.3
PDB Compounds: (A:) Streptogrisin-B

SCOPe Domain Sequences for d2qaaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qaaa_ b.47.1.1 (A:) automated matches {Streptomyces griseus [TaxId: 1911]}
isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
gvsvy

SCOPe Domain Coordinates for d2qaaa_:

Click to download the PDB-style file with coordinates for d2qaaa_.
(The format of our PDB-style files is described here.)

Timeline for d2qaaa_: