SCOP 1.75: Domain d2qaaa1: 2qaa A:16-242

Lineage for d2qaaa1 (2qaa A:16-242)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (15 proteins)

6. Protein Protease B [50508] (1 species)

7. Species Streptomyces griseus, strain k1 [TaxId:1911] [50509] (28 PDB entries)
   Streptogrisin B

8. Domain d2qaaa1: 2qaa A:16-242 [150201]
   automatically matched to d1sgde_
   complexed with acy, cl, edo, epe, gol, leu, so4, tyr

Details for d2qaaa1

PDB Entry: 2qaa, 1.23 Å

PDB Description: Crystal structure of the second tetrahedral intermediates of SGPB at pH 7.3

PDB Compounds: (A:) Streptogrisin-B

SCOP Domain Sequences for d2qaaa1:

Sequence; same for both SEQRES and ATOM records:

>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]}
isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
gvsvy

Timeline for d2qaaa1:

• d2qaaa1 is new in SCOP 1.75
  
• d2qaaa1 is called d2qaaa_ in SCOPe 2.01
  
• d2qaaa1 appears in the current release, SCOPe 2.08, called d2qaaa_