SCOPe 2.08: Domain d2qaaa_: 2qaa A:

Lineage for d2qaaa_ (2qaa A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein automated matches [190306] (9 species)
   not a true protein

7. Species Streptomyces griseus [TaxId:1911] [187119] (8 PDB entries)

8. Domain d2qaaa_: 2qaa A: [150201]
   automated match to d1sgde_
   complexed with acy, cl, edo, epe, gol, so4, tyr

Details for d2qaaa_

PDB Entry: 2qaa, 1.23 Å

PDB Description: Crystal structure of the second tetrahedral intermediates of SGPB at pH 7.3

PDB Compounds: (A:) Streptogrisin-B

SCOPe Domain Sequences for d2qaaa_:

Sequence; same for both SEQRES and ATOM records:

>d2qaaa_ b.47.1.1 (A:) automated matches {Streptomyces griseus [TaxId: 1911]}
isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
gvsvy

Timeline for d2qaaa_:

• d2qaaa_ first appeared in SCOP 1.75, called d2qaaa1
  
• d2qaaa_ appears in SCOPe 2.07