Class i: Low resolution protein structures [58117] (26 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (1 protein) |
Protein 50S subunit [58125] (6 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
Domain d2qa4x1: 2qa4 X:7-88 [150197] Other proteins in same PDB: d2qa421, d2qa4b1, d2qa4c1, d2qa4f1, d2qa4g1, d2qa4h1, d2qa4i1, d2qa4k1, d2qa4m1, d2qa4p1, d2qa4r1, d2qa4s1, d2qa4y1, d2qa4z1 automatically matched to d1w2bw_ complexed with cd, cl, k, mg, na, omg, omu, psu, ur3 |
PDB Entry: 2qa4 (more details), 3 Å
SCOP Domain Sequences for d2qa4x1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qa4x1 i.1.1.2 (X:7-88) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]} ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant pskirvraarfeeegeaiveae
Timeline for d2qa4x1:
View in 3D Domains from other chains: (mouse over for more information) d2qa411, d2qa421, d2qa431, d2qa4b1, d2qa4c1, d2qa4d1, d2qa4f1, d2qa4g1, d2qa4h1, d2qa4i1, d2qa4j1, d2qa4k1, d2qa4l1, d2qa4m1, d2qa4n1, d2qa4o1, d2qa4p1, d2qa4q1, d2qa4r1, d2qa4s1, d2qa4t1, d2qa4u1, d2qa4v1, d2qa4w1, d2qa4y1, d2qa4z1 |