Lineage for d2qa4x1 (2qa4 X:7-88)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 897176Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 897177Protein 50S subunit [58125] (6 species)
  7. 897178Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 897430Domain d2qa4x1: 2qa4 X:7-88 [150197]
    Other proteins in same PDB: d2qa421, d2qa4b1, d2qa4c1, d2qa4f1, d2qa4g1, d2qa4h1, d2qa4i1, d2qa4k1, d2qa4m1, d2qa4p1, d2qa4r1, d2qa4s1, d2qa4y1, d2qa4z1
    automatically matched to d1w2bw_
    complexed with cd, cl, k, mg, na, omg, omu, psu, ur3

Details for d2qa4x1

PDB Entry: 2qa4 (more details), 3 Å

PDB Description: A more complete structure of the the L7/L12 stalk of the Haloarcula marismortui 50S large ribosomal subunit
PDB Compounds: (X:) 50S ribosomal protein L31e

SCOP Domain Sequences for d2qa4x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qa4x1 i.1.1.2 (X:7-88) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOP Domain Coordinates for d2qa4x1:

Click to download the PDB-style file with coordinates for d2qa4x1.
(The format of our PDB-style files is described here.)

Timeline for d2qa4x1: