Lineage for d2qa4s1 (2qa4 S:1-81)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891281Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 1891282Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 1891283Family d.12.1.1: L23p [54190] (1 protein)
    automatically mapped to Pfam PF00276
  6. 1891284Protein Ribosomal protein L23 [54191] (4 species)
  7. 1891323Species Haloarcula marismortui [TaxId:2238] [54192] (58 PDB entries)
    Uniprot P12732
  8. 1891379Domain d2qa4s1: 2qa4 S:1-81 [150192]
    Other proteins in same PDB: d2qa411, d2qa421, d2qa431, d2qa4b1, d2qa4c1, d2qa4d1, d2qa4f1, d2qa4g1, d2qa4h1, d2qa4i1, d2qa4j1, d2qa4k1, d2qa4l1, d2qa4m1, d2qa4n1, d2qa4o1, d2qa4p1, d2qa4q1, d2qa4r1, d2qa4t1, d2qa4u1, d2qa4v1, d2qa4w1, d2qa4x1, d2qa4y1, d2qa4z1
    automatically matched to d1jj2r_
    complexed with cd, cl, k, mg, na

Details for d2qa4s1

PDB Entry: 2qa4 (more details), 3 Å

PDB Description: A more complete structure of the the L7/L12 stalk of the Haloarcula marismortui 50S large ribosomal subunit
PDB Compounds: (S:) 50S ribosomal protein L23P

SCOPe Domain Sequences for d2qa4s1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qa4s1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

SCOPe Domain Coordinates for d2qa4s1:

Click to download the PDB-style file with coordinates for d2qa4s1.
(The format of our PDB-style files is described here.)

Timeline for d2qa4s1: