Lineage for d2qa4p1 (2qa4 P:1-143)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742039Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 1742040Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
    automatically mapped to Pfam PF01280
  5. 1742041Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 1742042Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 1742043Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 1742099Domain d2qa4p1: 2qa4 P:1-143 [150189]
    Other proteins in same PDB: d2qa411, d2qa421, d2qa431, d2qa4b1, d2qa4c1, d2qa4d1, d2qa4f1, d2qa4g1, d2qa4h1, d2qa4i1, d2qa4j1, d2qa4k1, d2qa4l1, d2qa4m1, d2qa4n1, d2qa4o1, d2qa4q1, d2qa4r1, d2qa4s1, d2qa4t1, d2qa4u1, d2qa4v1, d2qa4w1, d2qa4x1, d2qa4y1, d2qa4z1
    automatically matched to d1s72p_
    complexed with cd, cl, k, mg, na

Details for d2qa4p1

PDB Entry: 2qa4 (more details), 3 Å

PDB Description: A more complete structure of the the L7/L12 stalk of the Haloarcula marismortui 50S large ribosomal subunit
PDB Compounds: (P:) 50S ribosomal protein L19e

SCOPe Domain Sequences for d2qa4p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qa4p1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOPe Domain Coordinates for d2qa4p1:

Click to download the PDB-style file with coordinates for d2qa4p1.
(The format of our PDB-style files is described here.)

Timeline for d2qa4p1: