Lineage for d2qa4o1 (2qa4 O:1-115)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1070374Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1070375Protein 50S subunit [58125] (6 species)
  7. 1070524Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1070770Domain d2qa4o1: 2qa4 O:1-115 [150188]
    Other proteins in same PDB: d2qa421, d2qa4b1, d2qa4c1, d2qa4f1, d2qa4g1, d2qa4h1, d2qa4i1, d2qa4k1, d2qa4m1, d2qa4p1, d2qa4r1, d2qa4s1, d2qa4y1, d2qa4z1
    automatically matched to d1w2bn_
    complexed with cd, cl, k, mg, na

Details for d2qa4o1

PDB Entry: 2qa4 (more details), 3 Å

PDB Description: A more complete structure of the the L7/L12 stalk of the Haloarcula marismortui 50S large ribosomal subunit
PDB Compounds: (O:) 50S ribosomal protein L18e

SCOPe Domain Sequences for d2qa4o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qa4o1 i.1.1.2 (O:1-115) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

SCOPe Domain Coordinates for d2qa4o1:

Click to download the PDB-style file with coordinates for d2qa4o1.
(The format of our PDB-style files is described here.)

Timeline for d2qa4o1: