Lineage for d2qa4n1 (2qa4 N:1-186)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2648151Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2648286Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2648433Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 2648483Domain d2qa4n1: 2qa4 N:1-186 [150187]
    Other proteins in same PDB: d2qa421, d2qa4b1, d2qa4c1, d2qa4f1, d2qa4g1, d2qa4h1, d2qa4i1, d2qa4k1, d2qa4m1, d2qa4p1, d2qa4r1, d2qa4s1, d2qa4y1, d2qa4z1
    automatically matched to d1w2bm_
    complexed with cd, cl, k, mg, na

Details for d2qa4n1

PDB Entry: 2qa4 (more details), 3 Å

PDB Description: A more complete structure of the the L7/L12 stalk of the Haloarcula marismortui 50S large ribosomal subunit
PDB Compounds: (N:) 50S ribosomal protein L18P

SCOPe Domain Sequences for d2qa4n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qa4n1 i.1.1.2 (N:1-186) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOPe Domain Coordinates for d2qa4n1:

Click to download the PDB-style file with coordinates for d2qa4n1.
(The format of our PDB-style files is described here.)

Timeline for d2qa4n1: