Class j: Peptides [58231] (126 folds) |
Fold j.84: Ribosomal protein L10 [64658] (1 superfamily) |
Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) |
Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein) |
Protein Ribosomal protein L10 [64661] (1 species) two alpha-helical segments visible in the crystal structure |
Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries) Uniprot P15825 |
Domain d2qa4g1: 2qa4 G:12-73 [150180] Other proteins in same PDB: d2qa411, d2qa421, d2qa431, d2qa4b1, d2qa4c1, d2qa4d1, d2qa4f1, d2qa4h1, d2qa4i1, d2qa4j1, d2qa4k1, d2qa4l1, d2qa4m1, d2qa4n1, d2qa4o1, d2qa4p1, d2qa4q1, d2qa4r1, d2qa4s1, d2qa4t1, d2qa4u1, d2qa4v1, d2qa4w1, d2qa4x1, d2qa4y1, d2qa4z1 automatically matched to 1VQ4 G:12-73 complexed with cd, cl, k, mg, na |
PDB Entry: 2qa4 (more details), 3 Å
SCOPe Domain Sequences for d2qa4g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qa4g1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]} ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral dd
Timeline for d2qa4g1:
View in 3D Domains from other chains: (mouse over for more information) d2qa411, d2qa421, d2qa431, d2qa4b1, d2qa4c1, d2qa4d1, d2qa4f1, d2qa4h1, d2qa4i1, d2qa4j1, d2qa4k1, d2qa4l1, d2qa4m1, d2qa4n1, d2qa4o1, d2qa4p1, d2qa4q1, d2qa4r1, d2qa4s1, d2qa4t1, d2qa4u1, d2qa4v1, d2qa4w1, d2qa4x1, d2qa4y1, d2qa4z1 |