SCOP 1.75: Domain d2q9za1: 2q9z A:3-354

Lineage for d2q9za1 (2q9z A:3-354)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (5 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.5: Trichodiene synthase [69113] (1 protein)

6. Protein Trichodiene synthase [69114] (1 species)

7. Species Fusarium sporotrichioides [TaxId:5514] [69115] (8 PDB entries)

8. Domain d2q9za1: 2q9z A:3-354 [150171]
   automatically matched to d1jfaa_
   complexed with edo, mg, pop

Details for d2q9za1

PDB Entry: 2q9z, 2.95 Å

PDB Description: Trichodiene synthase: Complex with inorganic pyrophosphate resulting from the reaction with 2-fluorofarnesyl diphosphate

PDB Compounds: (A:) trichodiene synthase

SCOP Domain Sequences for d2q9za1:

Sequence; same for both SEQRES and ATOM records:

>d2q9za1 a.128.1.5 (A:3-354) Trichodiene synthase {Fusarium sporotrichioides [TaxId: 5514]}
nfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdpkr
lqaslqtivgmvvyswakvskecmadlsihytytlvlddskddpyptmvnyfddlqagre
qahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqflr
rmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdqis
lvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhlcd
rryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv

Timeline for d2q9za1:

• d2q9za1 is new in SCOP 1.75
  
• d2q9za1 appears in SCOPe 2.01
  
• d2q9za1 appears in the current release, SCOPe 2.08, called d2q9za_