SCOPe 2.08: Domain d2q9ya_: 2q9y A:

Lineage for d2q9ya_ (2q9y A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.5: Trichodiene synthase [69113] (1 protein)
   automatically mapped to Pfam PF06330

6. Protein Trichodiene synthase [69114] (1 species)

7. Species Fusarium sporotrichioides [TaxId:5514] [69115] (20 PDB entries)

8. Domain d2q9ya_: 2q9y A: [150169]
   automated match to d1jfaa_
   complexed with btm, edo, mg, pop

Details for d2q9ya_

PDB Entry: 2q9y, 2.85 Å

PDB Description: Trichodiene synthase: Complex with Mg, inorganic pyrophosphate, and benzyl triethyl ammonium cation

PDB Compounds: (A:) trichodiene synthase

SCOPe Domain Sequences for d2q9ya_:

Sequence; same for both SEQRES and ATOM records:

>d2q9ya_ a.128.1.5 (A:) Trichodiene synthase {Fusarium sporotrichioides [TaxId: 5514]}
nfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdpkr
lqaslqtivgmvvyswakvskecmadlsihytytlvlddskddpyptmvnyfddlqagre
qahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqflr
rmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdqis
lvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhlcd
rryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv

Timeline for d2q9ya_:

• d2q9ya_ first appeared in SCOP 1.75, called d2q9ya1
  
• d2q9ya_ appears in SCOPe 2.07