SCOPe 2.05: Domain d2q9sa_: 2q9s A:

Lineage for d2q9sa_ (2q9s A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50857] (21 PDB entries)

8. Domain d2q9sa_: 2q9s A: [150168]
   automated match to d3p6da_
   complexed with eic, so4

Details for d2q9sa_

PDB Entry: 2q9s, 2.3 Å

PDB Description: linoleic acid bound to fatty acid binding protein 4

PDB Compounds: (A:) fatty acid-binding protein

SCOPe Domain Sequences for d2q9sa_:

Sequence; same for both SEQRES and ATOM records:

>d2q9sa_ b.60.1.2 (A:) Adipocyte lipid-binding protein, ALBP {Mouse (Mus musculus) [TaxId: 10090]}
cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfknt
eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvecvmk
gvtstrvyera

Timeline for d2q9sa_:

• d2q9sa_ first appeared in SCOP 1.75, called d2q9sa1
  
• d2q9sa_ appears in SCOPe 2.04
  
• d2q9sa_ appears in SCOPe 2.06
  
• d2q9sa_ appears in the current release, SCOPe 2.08