Lineage for d2q9qf1 (2q9q F:21-165)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781244Fold a.278: GINS helical bundle-like [158572] (1 superfamily)
    5 helices, staggered bundle;
  4. 781245Superfamily a.278.1: GINS helical bundle-like [158573] (4 families) (S)
    common to all subunits of the GINS complex
  5. 781274Family a.278.1.4: SLD5 N-terminal domain-like [158583] (1 protein)
    N-terminal part of Pfam PF05916
  6. 781275Protein GINS complex subunit 4, SLD5 [158584] (1 species)
  7. 781276Species Human (Homo sapiens) [TaxId:9606] [158585] (3 PDB entries)
    Uniprot Q9BRT9 21-165
  8. 781280Domain d2q9qf1: 2q9q F:21-165 [150164]
    Other proteins in same PDB: d2q9qa1, d2q9qa2, d2q9qb2, d2q9qd1, d2q9qd2, d2q9qe1, d2q9qe2, d2q9qf2, d2q9qh1, d2q9qh2
    automatically matched to 2E9X D:21-165

Details for d2q9qf1

PDB Entry: 2q9q (more details), 2.36 Å

PDB Description: The crystal structure of full length human GINS complex
PDB Compounds: (F:) GINS complex subunit 4

SCOP Domain Sequences for d2q9qf1:

Sequence, based on SEQRES records: (download)

>d2q9qf1 a.278.1.4 (F:21-165) GINS complex subunit 4, SLD5 {Human (Homo sapiens) [TaxId: 9606]}
ltpaelierleqawmnekfapelleskpeivecvmeqlehmeenlrrakredlkvsihqm
emeriryvlssylrcrlmkiekffphvlekektrpegepsslspeelafarefmantesy
lknvalkhmppnlqkvdlfravpkp

Sequence, based on observed residues (ATOM records): (download)

>d2q9qf1 a.278.1.4 (F:21-165) GINS complex subunit 4, SLD5 {Human (Homo sapiens) [TaxId: 9606]}
ltpaelierleqawmnekfapelleskpeivecvmeqlehmeenldlkvsihqmemerir
yvlssylrcrlmkiekffphvlekektrpegepsslspeelafarefmantesylknval
khmppnlqkvdlfravpkp

SCOP Domain Coordinates for d2q9qf1:

Click to download the PDB-style file with coordinates for d2q9qf1.
(The format of our PDB-style files is described here.)

Timeline for d2q9qf1: