Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily) beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold (55657) and the PsaD fold (64243) |
Superfamily d.344.1: PriA/YqbF domain [160059] (5 families) associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2) |
Family d.344.1.0: automated matches [254227] (1 protein) not a true family |
Protein automated matches [254515] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255135] (3 PDB entries) |
Domain d2q9qe2: 2q9q E:1-61 [150163] Other proteins in same PDB: d2q9qa1, d2q9qb1, d2q9qb2, d2q9qc_, d2q9qd1, d2q9qd2, d2q9qe1, d2q9qf1, d2q9qf2, d2q9qg_, d2q9qh1, d2q9qh2 automated match to d2q9qe2 |
PDB Entry: 2q9q (more details), 2.36 Å
SCOPe Domain Sequences for d2q9qe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q9qe2 d.344.1.0 (E:1-61) automated matches {Human (Homo sapiens) [TaxId: 9606]} mdaaeveflaekelvtiipnfsldkiyliggdlgpfnpglpvevplwlainlkqrqkcrl l
Timeline for d2q9qe2: