SCOPe 2.05: Domain d1vrfa_: 1vrf A:

Lineage for d1vrfa_ (1vrf A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Glycera globin [46467] (1 species)

7. Species Marine bloodworm (Glycera dibranchiata) [TaxId:6350] [46468] (8 PDB entries)

8. Domain d1vrfa_: 1vrf A: [15016]
   complexed with cmo, hem

Details for d1vrfa_

PDB Entry: 1vrf

PDB Description: solution structure of component iv glycera dibranchiata monomeric hemoglobin-co

PDB Compounds: (A:) protein (globin, monomeric component m-IV)

SCOPe Domain Sequences for d1vrfa_:

Sequence; same for both SEQRES and ATOM records:

>d1vrfa_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]}
glsaaqrqvvastwkdiagsdngagvgkecftkflsahhdmaavfgfsgasdpgvadlga
kvlaqigvavshlgdegkmvaemkavgvrhkgygnkhikaeyfeplgasllsamehrigg
kmnaaakdawaaayadisgalisglqs

Timeline for d1vrfa_:

• d1vrfa_ first appeared (with stable ids) in SCOP 1.55
  
• d1vrfa_ appears in SCOPe 2.04
  
• d1vrfa_ appears in SCOPe 2.06
  
• d1vrfa_ appears in the current release, SCOPe 2.08