Lineage for d2q9pa_ (2q9p A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535539Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2535540Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2535541Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2535673Protein Diphosphoinositol polyphosphate phosphohydrolase [143766] (1 species)
  7. 2535674Species Human (Homo sapiens) [TaxId:9606] [143767] (2 PDB entries)
    Uniprot O95989 8-142
  8. 2535676Domain d2q9pa_: 2q9p A: [150155]
    automated match to d2fvva1
    complexed with cl, f, ihp, mg

Details for d2q9pa_

PDB Entry: 2q9p (more details), 1.65 Å

PDB Description: Human diphosphoinositol polyphosphate phosphohydrolase 1, Mg-F complex
PDB Compounds: (A:) Diphosphoinositol polyphosphate phosphohydrolase 1

SCOPe Domain Sequences for d2q9pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q9pa_ d.113.1.1 (A:) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]}
rtydgdgykkraaclcfrseseeevllvsssrhpdrwivpgggmepeeepsvaavrevce
eagvkgtlgrlvgifenqerkhrtyvyvlivtevledwedsvnigrkrewfkiedaikvl
qyhkpvqasyfe

SCOPe Domain Coordinates for d2q9pa_:

Click to download the PDB-style file with coordinates for d2q9pa_.
(The format of our PDB-style files is described here.)

Timeline for d2q9pa_: