SCOP 1.75: Domain d2q9oa3: 2q9o A:344-559

Lineage for d2q9oa3 (2q9o A:344-559)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Laccase [49557] (5 species)
   consists of three domains of this fold

7. Species Melanocarpus albomyces [TaxId:204285] [74873] (4 PDB entries)

8. Domain d2q9oa3: 2q9o A:344-559 [150151]
   automatically matched to d1gw0a3
   complexed with cl, cu, gol, man, nag, ohi, oxy, so4

Details for d2q9oa3

PDB Entry: 2q9o, 1.3 Å

PDB Description: near-atomic resolution structure of a melanocarpus albomyces laccase

PDB Compounds: (A:) Laccase-1

SCOP Domain Sequences for d2q9oa3:

Sequence; same for both SEQRES and ATOM records:

>d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]}
rsvpvnsfvkrpdntlpvaldltgtplfvwkvngsdinvdwgkpiidyiltgntsypvsd
nivqvdavdqwtywliendpegpfslphpmhlhghdflvlgrspdvpaasqqrfvfdpav
dlarlngdnpprrdttmlpaggwlllafrtdnpgawlfhchiawhvsgglsvdflerpad
lrqrisqededdfnrvcdewraywptnpypkidsgl

Timeline for d2q9oa3:

• d2q9oa3 is new in SCOP 1.75
  
• d2q9oa3 appears in SCOPe 2.01
  
• d2q9oa3 appears in the current release, SCOPe 2.08