Lineage for d1hbga_ (1hbg A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 631774Protein Glycera globin [46467] (1 species)
  7. 631775Species Marine bloodworm (Glycera dibranchiata) [TaxId:6350] [46468] (8 PDB entries)
  8. 631781Domain d1hbga_: 1hbg A: [15015]
    complexed with hem

Details for d1hbga_

PDB Entry: 1hbg (more details), 1.5 Å

PDB Description: glycera dibranchiata hemoglobin. structure and refinement at 1.5 angstroms resolution
PDB Compounds: (A:) hemoglobin (carbonmonoxy)

SCOP Domain Sequences for d1hbga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbga_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]}
glsaaqrqviaatwkdiagadngagvgkkclikflsahpqmaavfgfsgasdpgvaalga
kvlaqigvavshlgdegkmvaqmkavgvrhkgygnkhikaqyfeplgasllsamehrigg
kmnaaakdawaaayadisgalisglqs

SCOP Domain Coordinates for d1hbga_:

Click to download the PDB-style file with coordinates for d1hbga_.
(The format of our PDB-style files is described here.)

Timeline for d1hbga_: