Lineage for d2q9oa1 (2q9o A:1-162)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 791145Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 791146Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 791546Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 791592Protein Laccase [49557] (5 species)
    consists of three domains of this fold
  7. 791600Species Melanocarpus albomyces [TaxId:204285] [74873] (4 PDB entries)
  8. 791601Domain d2q9oa1: 2q9o A:1-162 [150149]
    automatically matched to d1gw0a1
    complexed with cl, cu, gol, man, nag, ohi, oxy, so4

Details for d2q9oa1

PDB Entry: 2q9o (more details), 1.3 Å

PDB Description: near-atomic resolution structure of a melanocarpus albomyces laccase
PDB Compounds: (A:) Laccase-1

SCOP Domain Sequences for d2q9oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]}
eptcntpsnracwsdgfdintdyevstpdtgvtqsyvfnltevdnwmgpdgvvkekvmli
ngnimgpnivanwgdtvevtvinnlvtngtsihwhgihqkdtnlhdgangvtecpippkg
gqrtyrwrarqygtswyhshfsaqygngvvgtiqingpaslp

SCOP Domain Coordinates for d2q9oa1:

Click to download the PDB-style file with coordinates for d2q9oa1.
(The format of our PDB-style files is described here.)

Timeline for d2q9oa1: