SCOPe 2.03: Domain d2q9ja2: 2q9j A:131-274

Lineage for d2q9ja2 (2q9j A:131-274)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein)
   automatically mapped to Pfam PF01678

6. Protein Diaminopimelate epimerase [54508] (2 species)

7. Species Haemophilus influenzae [TaxId:727] [54509] (6 PDB entries)

8. Domain d2q9ja2: 2q9j A:131-274 [150146]
   automatically matched to d1bwza2
   complexed with edo, so4; mutant

Details for d2q9ja2

PDB Entry: 2q9j, 2.2 Å

PDB Description: crystal structure of the c217s mutant of diaminopimelate epimerase

PDB Compounds: (A:) Diaminopimelate epimerase

SCOPe Domain Sequences for d2q9ja2:

Sequence; same for both SEQRES and ATOM records:

>d2q9ja2 d.21.1.1 (A:131-274) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
tankfeknyilrtdiqtvlcgavsmgnphcvvqvddiqtanveqlgpllesherfpervn
agfmqiinkehiklrvyergagetqasgsgacaavavgimqgllnnnvqvdlpggslmie
wngvghplymtgeathiydgfitl

Timeline for d2q9ja2:

• d2q9ja2 first appeared in SCOP 1.75
  
• d2q9ja2 appears in SCOPe 2.02
  
• d2q9ja2 appears in SCOPe 2.04
  
• d2q9ja2 appears in the current release, SCOPe 2.08