Lineage for d2q9ja1 (2q9j A:1-130)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939535Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2939536Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2939537Family d.21.1.1: Diaminopimelate epimerase [54507] (2 proteins)
    automatically mapped to Pfam PF01678
  6. 2939538Protein Diaminopimelate epimerase [54508] (3 species)
  7. 2939548Species Haemophilus influenzae [TaxId:727] [54509] (6 PDB entries)
  8. 2939557Domain d2q9ja1: 2q9j A:1-130 [150145]
    automated match to d1bwza1
    complexed with edo, so4; mutant

Details for d2q9ja1

PDB Entry: 2q9j (more details), 2.2 Å

PDB Description: crystal structure of the c217s mutant of diaminopimelate epimerase
PDB Compounds: (A:) Diaminopimelate epimerase

SCOPe Domain Sequences for d2q9ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q9ja1 d.21.1.1 (A:1-130) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
mqfskmhglgndfvvvdgvtqnvfftpetirrlanrhcgigfdqlliveapydpeldfhy
rifnadgsevsqcgngarcfarfvtlkgltnkkdisvstqkgnmvltvkddnqirvnmge
piwepakipf

SCOPe Domain Coordinates for d2q9ja1:

Click to download the PDB-style file with coordinates for d2q9ja1.
(The format of our PDB-style files is described here.)

Timeline for d2q9ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q9ja2