SCOPe 2.06: Domain d2q9ha2: 2q9h A:131-274

Lineage for d2q9ha2 (2q9h A:131-274)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein)
   automatically mapped to Pfam PF01678

6. Protein Diaminopimelate epimerase [54508] (3 species)

7. Species Haemophilus influenzae [TaxId:727] [54509] (6 PDB entries)

8. Domain d2q9ha2: 2q9h A:131-274 [150144]
   automated match to d2gkea2
   complexed with acy, tla; mutant

Details for d2q9ha2

PDB Entry: 2q9h, 2.3 Å

PDB Description: crystal structure of the c73s mutant of diaminopimelate epimerase

PDB Compounds: (A:) Diaminopimelate epimerase

SCOPe Domain Sequences for d2q9ha2:

Sequence; same for both SEQRES and ATOM records:

>d2q9ha2 d.21.1.1 (A:131-274) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
tankfeknyilrtdiqtvlcgavsmgnphcvvqvddiqtanveqlgpllesherfpervn
agfmqiinkehiklrvyergagetqacgsgacaavavgimqgllnnnvqvdlpggslmie
wngvghplymtgeathiydgfitl

Timeline for d2q9ha2:

• d2q9ha2 first appeared in SCOP 1.75
  
• d2q9ha2 appears in SCOPe 2.05
  
• d2q9ha2 appears in SCOPe 2.07
  
• d2q9ha2 appears in the current release, SCOPe 2.08