Lineage for d2q9ha2 (2q9h A:131-274)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1407275Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 1407276Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 1407277Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein)
    automatically mapped to Pfam PF01678
  6. 1407278Protein Diaminopimelate epimerase [54508] (2 species)
  7. 1407288Species Haemophilus influenzae [TaxId:727] [54509] (6 PDB entries)
  8. 1407298Domain d2q9ha2: 2q9h A:131-274 [150144]
    automatically matched to d1bwza2
    complexed with acy, tla; mutant

Details for d2q9ha2

PDB Entry: 2q9h (more details), 2.3 Å

PDB Description: crystal structure of the c73s mutant of diaminopimelate epimerase
PDB Compounds: (A:) Diaminopimelate epimerase

SCOPe Domain Sequences for d2q9ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q9ha2 d.21.1.1 (A:131-274) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
tankfeknyilrtdiqtvlcgavsmgnphcvvqvddiqtanveqlgpllesherfpervn
agfmqiinkehiklrvyergagetqacgsgacaavavgimqgllnnnvqvdlpggslmie
wngvghplymtgeathiydgfitl

SCOPe Domain Coordinates for d2q9ha2:

Click to download the PDB-style file with coordinates for d2q9ha2.
(The format of our PDB-style files is described here.)

Timeline for d2q9ha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q9ha1