SCOPe 2.05: Domain d2hbga_: 2hbg A:

Lineage for d2hbga_ (2hbg A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Glycera globin [46467] (1 species)

7. Species Marine bloodworm (Glycera dibranchiata) [TaxId:6350] [46468] (8 PDB entries)

8. Domain d2hbga_: 2hbg A: [15014]
   complexed with hem

Details for d2hbga_

PDB Entry: 2hbg, 1.5 Å

PDB Description: glycera dibranchiata hemoglobin. structure and refinement at 1.5 angstroms resolution

PDB Compounds: (A:) hemoglobin (deoxy)

SCOPe Domain Sequences for d2hbga_:

Sequence; same for both SEQRES and ATOM records:

>d2hbga_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]}
glsaaqrqviaatwkdiagadngagvgkkclikflsahpqmaavfgfsgasdpgvaalga
kvlaqigvavshlgdegkmvaqmkavgvrhkgygnkhikaqyfeplgasllsamehrigg
kmnaaakdawaaayadisgalisglqs

Timeline for d2hbga_:

• d2hbga_ first appeared (with stable ids) in SCOP 1.55, called d2hbg__
  
• d2hbga_ appears in SCOPe 2.04
  
• d2hbga_ appears in SCOPe 2.06
  
• d2hbga_ appears in the current release, SCOPe 2.08