Lineage for d2hbga_ (2hbg A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686113Protein Glycera globin [46467] (1 species)
  7. 2686114Species Marine bloodworm (Glycera dibranchiata) [TaxId:6350] [46468] (8 PDB entries)
  8. 2686120Domain d2hbga_: 2hbg A: [15014]
    complexed with hem

Details for d2hbga_

PDB Entry: 2hbg (more details), 1.5 Å

PDB Description: glycera dibranchiata hemoglobin. structure and refinement at 1.5 angstroms resolution
PDB Compounds: (A:) hemoglobin (deoxy)

SCOPe Domain Sequences for d2hbga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hbga_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]}
glsaaqrqviaatwkdiagadngagvgkkclikflsahpqmaavfgfsgasdpgvaalga
kvlaqigvavshlgdegkmvaqmkavgvrhkgygnkhikaqyfeplgasllsamehrigg
kmnaaakdawaaayadisgalisglqs

SCOPe Domain Coordinates for d2hbga_:

Click to download the PDB-style file with coordinates for d2hbga_.
(The format of our PDB-style files is described here.)

Timeline for d2hbga_: