Lineage for d2q8za_ (2q8z A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 968402Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 968474Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 968597Protein Protozoan orotidine monophosphate decarboxylase [141749] (5 species)
  7. 968603Species Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId:36329] [159376] (5 PDB entries)
  8. 968604Domain d2q8za_: 2q8z A: [150133]
    automated match to d2f84a1
    complexed with 7pe, nup, peg, so4

Details for d2q8za_

PDB Entry: 2q8z (more details), 1.8 Å

PDB Description: Crystal structure of Plasmodium falciparum orotidine 5'-phosphate decarboxylase complexed with 6-amino-UMP
PDB Compounds: (A:) orotidine-monophosphate-decarboxylase

SCOPe Domain Sequences for d2q8za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q8za_ c.1.2.3 (A:) Protozoan orotidine monophosphate decarboxylase {Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId: 36329]}
glvprgsmgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyi
nnvsikkdillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygs
vgidvlknvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnml
kdicydeeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqn
nefigfvvgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinig
raitknpypqkaaqmyydqinailkqnmes

SCOPe Domain Coordinates for d2q8za_:

Click to download the PDB-style file with coordinates for d2q8za_.
(The format of our PDB-style files is described here.)

Timeline for d2q8za_: