Lineage for d1ebt__ (1ebt -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 61Protein Hemoglobin I [46464] (2 species)
  7. 89Species Clam (Lucina pectinata) [TaxId:244486] [46466] (4 PDB entries)
  8. 93Domain d1ebt__: 1ebt - [15013]

Details for d1ebt__

PDB Entry: 1ebt (more details), 1.9 Å

PDB Description: hemoglobin i from the clam lucina pectinata bound with cyanide

SCOP Domain Sequences for d1ebt__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebt__ a.1.1.2 (-) Hemoglobin I {Clam (Lucina pectinata)}
slsaaqkdnvtsswakasaawgtagpeffmalfdahddvfakfsglfsgaakgtvkntpe
maaqaqsfkglvsnwvdnldnagalegqcktfaanhkargisagqleaafkvlsgfmksy
ggdegawtavagalmgeiepnm

SCOP Domain Coordinates for d1ebt__:

Click to download the PDB-style file with coordinates for d1ebt__.
(The format of our PDB-style files is described here.)

Timeline for d1ebt__: