SCOPe 2.07: Domain d1ebta_: 1ebt A:

Lineage for d1ebta_ (1ebt A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 protein domains)
   Heme-binding protein

6. Protein Hemoglobin I [46464] (2 species)

7. Species Clam (Lucina pectinata) [TaxId:244486] [46466] (4 PDB entries)

8. Domain d1ebta_: 1ebt A: [15013]
   complexed with cyn, hem

Details for d1ebta_

PDB Entry: 1ebt, 1.9 Å

PDB Description: hemoglobin i from the clam lucina pectinata bound with cyanide

PDB Compounds: (A:) hemoglobin

SCOPe Domain Sequences for d1ebta_:

Sequence; same for both SEQRES and ATOM records:

>d1ebta_ a.1.1.2 (A:) Hemoglobin I {Clam (Lucina pectinata) [TaxId: 244486]}
slsaaqkdnvtsswakasaawgtagpeffmalfdahddvfakfsglfsgaakgtvkntpe
maaqaqsfkglvsnwvdnldnagalegqcktfaanhkargisagqleaafkvlsgfmksy
ggdegawtavagalmgeiepnm

Timeline for d1ebta_:

• d1ebta_ first appeared (with stable ids) in SCOP 1.55, called d1ebt__
  
• d1ebta_ appears in SCOPe 2.06