Lineage for d1ebta_ (1ebt A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686141Protein Hemoglobin I [46464] (2 species)
  7. 2686233Species Clam (Lucina pectinata) [TaxId:244486] [46466] (4 PDB entries)
  8. 2686236Domain d1ebta_: 1ebt A: [15013]
    complexed with cyn, hem

Details for d1ebta_

PDB Entry: 1ebt (more details), 1.9 Å

PDB Description: hemoglobin i from the clam lucina pectinata bound with cyanide
PDB Compounds: (A:) hemoglobin

SCOPe Domain Sequences for d1ebta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebta_ a.1.1.2 (A:) Hemoglobin I {Clam (Lucina pectinata) [TaxId: 244486]}
slsaaqkdnvtsswakasaawgtagpeffmalfdahddvfakfsglfsgaakgtvkntpe
maaqaqsfkglvsnwvdnldnagalegqcktfaanhkargisagqleaafkvlsgfmksy
ggdegawtavagalmgeiepnm

SCOPe Domain Coordinates for d1ebta_:

Click to download the PDB-style file with coordinates for d1ebta_.
(The format of our PDB-style files is described here.)

Timeline for d1ebta_: