Lineage for d2q8oa1 (2q8o A:49-173)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.22: TNF-like [49841] (1 superfamily)
sandwich, 10 strands in 2 sheets; jelly-rollSuperfamily b.22.1: TNF-like [49842] (2 families) 
Family b.22.1.1: TNF-like [49843] (15 proteins) 
Protein Glucocorticoid-induced TNF-related ligand, TNFSF18 [158982] (4 species) Species Mouse (Mus musculus) [TaxId:10090] [158983] (4 PDB entries)
Uniprot Q7TS55 51-173! Uniprot Q80YG2 49-173
Domain d2q8oa1: 2q8o A:49-173 [150129]
Details for d2q8oa1
PDB Entry: 2q8o (more details), 1.75 Å
PDB Description: crystal structure of mouse GITR ligand dimer
PDB Compounds: (A:) GITR ligandSCOPe Domain Sequences for d2q8oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q8oa1 b.22.1.1 (A:49-173) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Mouse (Mus musculus) [TaxId: 10090]}
iescmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkkyikdnap
fvvqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqknntywgiilmpd
lpfis
SCOPe Domain Coordinates for d2q8oa1:
Click to download the PDB-style file with coordinates for d2q8oa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2q8oa1:
- d2q8oa1 first appeared in SCOP 1.75
- d2q8oa1 appears in SCOPe 2.07
View in 3D
