SCOPe 2.08: Domain d2q8bh_: 2q8b H:

Lineage for d2q8bh_ (2q8b H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d2q8bh_: 2q8b H: [150125]
   Other proteins in same PDB: d2q8bl1, d2q8bl2
   automated match to d6shgh_

Details for d2q8bh_

PDB Entry: 2q8b, 2.3 Å

PDB Description: Structure of the malaria antigen AMA1 in complex with a growth-inhibitory antibody

PDB Compounds: (H:) 1F9 heavy chain

SCOPe Domain Sequences for d2q8bh_:

Sequence, based on SEQRES records:

>d2q8bh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaellrpgasvklscivsgfkikdtsmhwvkqrpeqglewigridpandnsey
dpkfqgkatitadtssntaylqlssltsedtavyyctlshfwgqgttltvssakttppsv
yplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytmsssv
tvpsstwpsqtvtcsvahpassttvdkkle

Sequence, based on observed residues (ATOM records):

>d2q8bh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaellrpgasvklscivsgfkikdtsmhwvkqrpeqglewigridpandnsey
dpkfqgkatitadtssntaylqlssltsedtavyyctlshfwgqgttltvssakttppsv
yplapgcssvtlgclvkgyfpesvtvtwnsvhtfpallqsglytmsssvtvpsstwpsqt
vtcsvahpassttvdkkle

Timeline for d2q8bh_:

• d2q8bh_ first appeared in SCOP 1.75, called d2q8bh1
  
• d2q8bh_ was called d2q8bh1 in SCOPe 2.07