SCOPe 2.08: Domain d2q8ah_: 2q8a H:

Lineage for d2q8ah_ (2q8a H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d2q8ah_: 2q8a H: [150124]
   Other proteins in same PDB: d2q8al1, d2q8al2
   automated match to d6shgh_

Details for d2q8ah_

PDB Entry: 2q8a, 2.4 Å

PDB Description: structure of the malaria antigen ama1 in complex with a growth- inhibitory antibody

PDB Compounds: (H:) 1F9 heavy chain

SCOPe Domain Sequences for d2q8ah_:

Sequence, based on SEQRES records:

>d2q8ah_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaellkpgasvklscivsgfkikdtsmhwvkqrpeqglewigridpandnsey
dpkfqgkatitadtssntaylqlssltsedtavyyctlshfwgqgttltvssakttppsv
yplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytmsssv
tvpsstwpsqtvtcsvahpassttvdkk

Sequence, based on observed residues (ATOM records):

>d2q8ah_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaellkpgasvklscivsgfkikdtsmhwvkqrpeqglewigridpandnsey
dpkfqgkatitadtssntaylqlssltsedtavyyctlshfwgqgttltvssakttppsv
yplapgcgssvtlgclvkgyfpesvtvtwnssvhtfpallqsglytmsssvtvpsstwps
qtvtcsvahpassttvdkk

Timeline for d2q8ah_:

• d2q8ah_ first appeared in SCOP 1.75, called d2q8ah1
  
• d2q8ah_ was called d2q8ah1 in SCOPe 2.07