Lineage for d2q86d1 (2q86 D:3-111)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1766639Domain d2q86d1: 2q86 D:3-111 [150122]
    Other proteins in same PDB: d2q86b2, d2q86d2
    automated match to d1tcrb1
    complexed with nag

Details for d2q86d1

PDB Entry: 2q86 (more details), 1.85 Å

PDB Description: structure of the mouse invariant nkt cell receptor valpha14
PDB Compounds: (D:) Vbeta8.2

SCOPe Domain Sequences for d2q86d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q86d1 b.1.1.0 (D:3-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvle

SCOPe Domain Coordinates for d2q86d1:

Click to download the PDB-style file with coordinates for d2q86d1.
(The format of our PDB-style files is described here.)

Timeline for d2q86d1: