![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein T-cell antigen receptor [49125] (7 species) |
![]() | Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries) |
![]() | Domain d2q86b2: 2q86 B:112-235 [150121] Other proteins in same PDB: d2q86a1, d2q86a2, d2q86b1, d2q86c1, d2q86c2, d2q86d1 automated match to d1tcrb2 complexed with bma, fuc, man, nag |
PDB Entry: 2q86 (more details), 1.85 Å
SCOPe Domain Sequences for d2q86b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q86b2 b.1.1.2 (B:112-235) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvctdpq aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea wgra
Timeline for d2q86b2: